Home > Product > Antimicrobial Peptides > Bacteriocin lactocin-S

Antimicrobial Peptides

Bacteriocin lactocin-S

[Price Inquiry]
CAT#
AF2680
Sequence
STPVLASVAVSMELLPTASVLYSDVAGCFKYSAKHHC
Host Chemicals
Lactobacillus sakei L45
Length
37
Activity
Antibacterial
SwissProt ID
P23826
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2017 Creative Peptides. All rights reserved.