Home > Product > Antimicrobial Peptides > Bacteriocin lactococcin MMFII

Antimicrobial Peptides

Bacteriocin lactococcin MMFII

[Price Inquiry]
CAT#
AF2683
Sequence
TSYGNGVHCNKSKCWIDVSELETYKAGTVSNPKDILW
Host Chemicals
Lactococcus lactis subsp. lactis
Length
37
Activity
Antibacterial
SwissProt ID
P83002
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.