Home > Product > Antimicrobial Peptides > Bacteriocin leucocin-B

Antimicrobial Peptides

Bacteriocin leucocin-B

[Price Inquiry]
CAT#
AF2049
Sequence
KGKGFWSWASKATSWLTGPQQPGSPLLKKHR
Host Chemicals
Leuconostoc mesenteroides
Length
31
Activity
Antibacterial
SwissProt ID
P81052
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.