Home > Product > Antimicrobial Peptides > Bacteriocin leucocin C

Antimicrobial Peptides

warning All products are for research use only. Not for human use.

Bacteriocin leucocin C

[Price Inquiry]
CAT#
AF3005
Sequence
KNYGNGVHCTKKGCSVDWGYAWTNIANNSVMNGLTGGNAGWHN
Host Chemicals
Leuconostoc mesenteroides
Length
43
Activity
Antibacterial
SwissProt ID
P81053
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.