Home > Product > Antimicrobial Peptides > Bacteriocin LS2

Antimicrobial Peptides

warning All products are for research use only. Not for human use.

Bacteriocin LS2

[Price Inquiry]
CAT#
AF2916
Sequence
TNWKKIGKCYAGTLGSAVLGFGAMGPVGYWAGAGVGYASFC
Host Chemicals
Lactobacillus salivarius BGHO1
Length
41
Activity
Antimicrobial
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.