Keywords Search Google Search Search

Bacteriocin LS2

Specification Technical Data Related Products Featured Products Customer reviews and Q&A Useful Tools Publications

CAT#	AF2916
Sequence	TNWKKIGKCYAGTLGSAVLGFGAMGPVGYWAGAGVGYASFC
Activity	Antimicrobial

CAT#	Product Name	Inquiry
AF557	TAC1_CARRO Tachyplesin-1	Inquiry
AF2712	OdP2a	Inquiry
AF1479	Winter flounder 4	Inquiry
AF1141	Caerin-4.1	Inquiry
AF894	Odorranain-C-MG2 antimicrobial peptide precursor	Inquiry

CAT#	Product Name	M.W	Molecular Formula	Inquiry
10-101-20	Goserelin Acetate	1269.43	C59H84N18O14	Inquiry
10-101-59	Liraglutide	3751.2	C172H265N43O51	Inquiry
R1574	Octreotide	1019.24	C₄₉H₆₆N₁₀O₁₀S₂	Inquiry
10-101-139	Myrcludex B			Inquiry
10-101-285	Teduglutide	3752.08	C164H252N44O55S	Inquiry
R1847	Sermaglutide	4114	C187H291N45O59	Inquiry
R1961	Carbetocin	988.2	C45H69N11O12S	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

Function of icatibant in hereditary angioedema

Icatibant, sold under the trade name Firazyr, is a plasma kallikrein inhibitor and the bradykinin B2 receptor an ...

Conantokin-T, a naturally peptidic NMDA receptor antagonist

Conantokin-T (Gly-Glu-Gla-Gla-Tyr-Gln-Lys-Met-Leu-Gla-Asn-Leu-Arg-Gla-Ala-Glu-Val-Lys-Asn-Ala-NH2), a 21-amino a ...

Function of caprooyl tetrapeptide-3 in skin

Caprooyl tetrapeptide-3, an anti-wrinkle peptide, a reaction product of caproic acid and tetrapeptide-3, compris ...

Inhibitors of Aspartic Proteases-Acetyl Pepstatin

Acetyl pepstatin, nature products of yeast fermentation, is general inhibitors of the family of aspartic proteas ...

Function of thymosin β15 in metastatic prostate cancer diagnosis

As a small actin-binding protein upregulated in highly metastatic prostate cancer cells, thymosin β15 (Tβ15) has ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address:

Host Chemicals	Lactobacillus salivarius BGHO1
Length	41