Home > Product > Antimicrobial Peptides > Bacteriocin OR-7

Antimicrobial Peptides

warning All products are for research use only. Not for human use.

Bacteriocin OR-7

[Price Inquiry]
CAT#
AF3306
Sequence
KTYYGTNGVHCTKNSLWGKVRLKNMKYDQNTTYMGRLQDILLGWATGAFGKTFH
Host Chemicals
Lactobacillus salivarius strain NRRL B-30514
Length
54
Activity
Gram-,
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.