Home > Product > Antimicrobial Peptides > Bacteriocin OR-7

Antimicrobial Peptides

Bacteriocin OR-7

Price Inquiry
CAT#
AF3306
Sequence
KTYYGTNGVHCTKNSLWGKVRLKNMKYDQNTTYMGRLQDILLGWATGAFGKTFH
Host Chemicals
Lactobacillus salivarius strain NRRL B-30514
Length
54
Activity
Gram-,

Online Inquiry

First Name:
Last Name:
Phone:
Email: *
Service & Products of Interest: *
Services Required and Project Description:
Verification code: *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.