Home > Product > Antimicrobial Peptides > Bacteriocin plantarican ASM1

Antimicrobial Peptides

Bacteriocin plantarican ASM1

[Price Inquiry]
CAT#
AF3007
Sequence
KPAWCWYTLAMCGAGYDSGTCDYMYSHCFGVKHSSGGGGSYHC
Host Chemicals
Lactobacillus plantarum A-1
Length
43
Activity
Antibacterial
SwissProt ID
C7G1H4
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.