Home > Product > Antimicrobial Peptides > Bacteriocin SRCAM 1580

Antimicrobial Peptides

Bacteriocin SRCAM 1580

[Price Inquiry]
CAT#
AF2474
Sequence
VNYGNGVSCSKTKCSVNWGIITHQAFRVTSGVASG
Host Chemicals
Paenibacillus polymyxa
Length
35
Activity
Antibacterial
SwissProt ID
P86394
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.