Home > Product > Antimicrobial Peptides > Bacteriocin SRCAM 602

Antimicrobial Peptides

Bacteriocin SRCAM 602

[Price Inquiry]
CAT#
AF2759
Sequence
ATYYGNGLYCNKQKHYTWVDWNKASREIGKITVNGWVQH
Host Chemicals
Paenibacillus polymyxa
Length
39
Activity
Antibacterial
SwissProt ID
P86393
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.