Home > Product > Antimicrobial Peptides > Bacteriocin sublancin-168

Antimicrobial Peptides

Bacteriocin sublancin-168

[Price Inquiry]
CAT#
AF2623
Sequence
GLGKAQCAALWLQCASGGTIGCGGGAVACQNYRQFCR
Host Chemicals
Bacillus phage SPbeta
Length
37
Activity
Antibacterial
SwissProt ID
P68578
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.