Home > Product > Catalog Peptides > Others > Bcl-2 Binding Peptide, Bad BH3 Peptide

Others

Bcl-2 Binding Peptide, Bad BH3 Peptide

[Price Inquiry]
CAT#
C08044
Sequence
LWAAQRYGRELRHLWAAQRYGRELRRMSDEFEGSFKGL
M.W/Mr.
3003.4
Length
38
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.