Home > Product > Catalog Peptides > Labeled Amyloid Peptides > Beta-Amyloid (1-28), FAM--labeled

Labeled Amyloid Peptides

Beta-Amyloid (1-28), FAM--labeled

Price Inquiry
CAT#
A13223
Sequence
FAM-DAEFRHDSGYEVHHQKLVFFAEDVGSNK
M.W/Mr.
3675
Length
32

Online Inquiry

First Name:
Last Name:
Phone:
Email: *
Service & Products of Interest: *
Services Required and Project Description:
Verification code: *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.