Home > Product > Catalog Peptides > Labeled Amyloid Peptides > Beta-Amyloid (1-28), FAM--labeled

Labeled Amyloid Peptides

Beta-Amyloid (1-28), FAM--labeled

[Price Inquiry]
CAT#
A13223
Sequence
FAM-DAEFRHDSGYEVHHQKLVFFAEDVGSNK
M.W/Mr.
3675
Length
32
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.