β-Amyloid (1-42), (1-40), (1-46) and Fragments

Beta Amyloid (11-40)

[Price Inquiry]
CAT#
A13195
Sequence
EVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
M.W/Mr.
3151.7
Molecular Formula
C143H228N38O40S1
Length
30
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.