β-Amyloid (1-42), (1-40), (1-46) and Fragments

Beta Amyloid (1-30)

[Price Inquiry]
CAT#
A13209
Sequence
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGA
M.W/Mr.
3390.6
Molecular Formula
C150H217N43O48
Length
30
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.