β-Amyloid (1-42), (1-40), (1-46) and Fragments

Beta-Amyloid (9-42)

[Price Inquiry]
CAT#
A13216
Sequence
GYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
M.W/Mr.
3556.2
Length
34
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.