Keywords Search Google Search Search

Beta-Amyloid (6-42)

Specification Technical Data Related Products Featured Products Customer reviews and Q&A Useful Tools Publications

CAT#	A13233
M.W/Mr.	3895.4
Sequence	HDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA

CAT#	Product Name	Inquiry
A13075	Beta-Amyloid (1-13)	Inquiry
A13382	Amyloid beta-Protein (40-1)	Inquiry
A13029	Beta-Amyloid (16-26)	Inquiry
A13110	Beta-Amyloid (1-16), mouse, rat	Inquiry
A13347	Beta-Amyloid (16-20)	Inquiry

CAT#	Product Name	M.W	Molecular Formula	Inquiry
10-101-20	Goserelin Acetate	1269.43	C59H84N18O14	Inquiry
10-101-59	Liraglutide	3751.2	C172H265N43O51	Inquiry
R1574	Octreotide	1019.24	C₄₉H₆₆N₁₀O₁₀S₂	Inquiry
10-101-139	Myrcludex B			Inquiry
10-101-285	Teduglutide	3752.08	C164H252N44O55S	Inquiry
R1847	Sermaglutide	4114	C187H291N45O59	Inquiry
R1961	Carbetocin	988.2	C45H69N11O12S	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

Function of (d(CH2)51, Tyr(Me)2, Arg8)-vasopressin in hyponatremia, ventricular tachycardia and defibrillation

(d(CH2)51,Tyr(Me)2,Arg8)-vasopressin, a kind of vasopressin, is a prohormone in neurons in the hypothalamus. Vas ...

ProTx II, a selective inhibitor of NaV1.7 sodium channel

ProTx II, a 30-amino acid, disulfide-rich peptide toxin, isolated from the venom of the tarantula, Thrixopelma ...

Introduction of Pentapeptide-3

Factors of natural aging Natural aging of the skin results in decreased production and increased degradation of extracellula ...

CXCR4 antagonist-TC 14012

TC 14012 is a serum-stable derivative of the peptidomimetic T140, which is a cyclic peptide with the structure o ...

Palmitoyl Tripeptide-5

of skin aging Natural aging of the skin results in decreased production and increased degradation of extracellu ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address: