Home > Product > Catalog Peptides > β-Amyloid (1-42), (1-40), (1-46) and Fragments > Beta-Amyloid (8-40), mouse, rat

β-Amyloid (1-42), (1-40), (1-46) and Fragments

warning All products are for research use only. Not for human use.

Beta-Amyloid (8-40), mouse, rat

[Price Inquiry]
CAT#
A13212
Sequence
SGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVV
M.W/Mr.
3462.0
Length
33
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.