Home > Product > Catalog Peptides > Others > Beta-Amyloid (1-40) (S26C) Dimer

Others

Beta-Amyloid (1-40) (S26C) Dimer

[Price Inquiry]
CAT#
A13364
Sequence
DAEFRHDSGYEVHHQKLVFFAEDVGCNKGAIIGLMVGGVV(dimer
M.W/Mr.
8690.8
Length
46
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.