Home > Product > Catalog Peptides > Others > Beta-Amyloid (1-40) (S26C) Dimer

Others

Beta-Amyloid (1-40) (S26C) Dimer

Price Inquiry
CAT#
A13364
Sequence
DAEFRHDSGYEVHHQKLVFFAEDVGCNKGAIIGLMVGGVV(dimer
M.W/Mr.
8690.8
Length
46

Online Inquiry

First Name:
Last Name:
Phone:
Email: *
Service & Products of Interest: *
Services Required and Project Description:
Verification code: *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.