Home > Product > Antimicrobial Peptides > Beta-defensin 107A

Antimicrobial Peptides

Beta-defensin 107A

[Price Inquiry]
CAT#
AF3054
Sequence
AIHRALISKRMEGHCEAECLTFEVKTGGCRAELAPFCCKNRKKH
Host Chemicals
Pan troglodytes
Length
44
Activity
Antibacterial
SwissProt ID
Q5IAA9
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.