Home > Product > Antimicrobial Peptides > Beta-defensin 7 , BNBD-7

Antimicrobial Peptides

Beta-defensin 7 , BNBD-7

[Price Inquiry]
CAT#
AF2822
Sequence
EGVRNFVTCRINRGFCVPIRCPGHRRQIGTCLGPRIKCCR
Host Chemicals
Bos taurus
Length
40
Activity
Antibacterial
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.