Home > Product > Antimicrobial Peptides > Beta-defensin 4 , BNBD-4

Antimicrobial Peptides

Beta-defensin 4 , BNBD-4

[Price Inquiry]
CAT#
AF2875
Sequence
ERVRNPQSCRWNMGVCIPFLCRVGMRQIGTCFGPRVPCCRR
Host Chemicals
Bos taurus
Length
41
Activity
Antibacterial
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.