Home > Product > Antimicrobial Peptides > Beta-defensin 3 , BNBD-3

Antimicrobial Peptides

Beta-defensin 3 , BNBD-3

[Price Inquiry]
CAT#
AF2931
Sequence
EGVRNHVTCRINRGFCVPIRCPGRTRQIGTCFGPRIKCCRSW
Host Chemicals
Bos taurus
Length
42
Activity
Antibacterial
SwissProt ID
P46161
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.