Keywords Search Google Search Search

Beta-defensin 3 , BNBD-3

Specification Technical Data Related Products Featured Products Customer reviews and Q&A Useful Tools Publications

CAT#	AF2931
Sequence	EGVRNHVTCRINRGFCVPIRCPGRTRQIGTCFGPRIKCCRSW
Activity	Antibacterial

CAT#	Product Name	Inquiry
AF435	Nigroain-D3	Inquiry
AF498	Ranatuerin-2R	Inquiry
AF555	Pm_mastoparan PMM	Inquiry
AF469	Alyteserin-2Mb	Inquiry
AF151	Bactenecin-1	Inquiry

CAT#	Product Name	M.W	Molecular Formula	Inquiry
10-101-20	Goserelin Acetate	1269.43	C59H84N18O14	Inquiry
10-101-59	Liraglutide	3751.2	C172H265N43O51	Inquiry
R1574	Octreotide	1019.24	C₄₉H₆₆N₁₀O₁₀S₂	Inquiry
10-101-139	Myrcludex B			Inquiry
10-101-285	Teduglutide	3752.08	C164H252N44O55S	Inquiry
R1847	Sermaglutide	4114	C187H291N45O59	Inquiry
R1961	Carbetocin	988.2	C45H69N11O12S	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

The Function of Deslorelin Acetate in Advanced Prostate Cancer

Deslorelin acetate, marketed under the trade names Ovuplant, SucroMate and Suprelorin, is an injectable gonadotr ...

The Function of Aviptadil Acetate on the Treatment of Pulmonary Arterial Hypertension

Aviptadil acetate, the nonproprietary or generic name for a vasoactive intestinal peptide (VIP), is a synthetic ...

Function of lepirudin in heparin-induced thrombocytopenia

Developed by the German company Hoechst Marion Roussel and derived from genetic modification of hirudin, lepirud ...

Orexin Peptides

Brief information of orexin peptide The past several years have provided important insights into the physiological significan ...

Function of dynorphin A (1-13) in ischemic brain injury

Dynorphin A (1-13) [Dyn-A (1-13)] is a short-chain polypeptide containing 13 amino acids and having extensive bi ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address:

Host Chemicals	Bos taurus
Length	42
SwissProt ID	P46161