Home > Product > Antimicrobial Peptides > Beta-defensin 6 , BNBD-6

Antimicrobial Peptides

Beta-defensin 6 , BNBD-6

[Price Inquiry]
CAT#
AF2932
Sequence
EGVRNHVTCRIYGGFCVPIRCPGRTRQIGTCFGRPVKCCRRW
Host Chemicals
Bos taurus
Length
42
Activity
Antibacterial
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.