Home > Product > Antimicrobial Peptides > Beta-defensin 12 , BNDB-12

Antimicrobial Peptides

Beta-defensin 12 , BNDB-12

[Price Inquiry]
CAT#
AF2713
Sequence
GPLSCGRNGGVCIPIRCPVPMRQIGTCFGRPVKCCRSW
Host Chemicals
Bos taurus
Length
38
Activity
Antibacterial
SwissProt ID
P46170
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.