Home > Product > Antimicrobial Peptides > Beta-defensin 9 , BNDB-9

Antimicrobial Peptides

Beta-defensin 9 , BNDB-9

[Price Inquiry]
CAT#
AF2851
Sequence
QGVRNFVTCRINRGFCVPIRCPGHRRQIGTCLAPQIKCCR
Host Chemicals
Bos taurus
Length
40
Activity
Antibacterial
SwissProt ID
P46167
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.