Home > Product > Antimicrobial Peptides > Beta-defensin 8 , gallinacin - 8

Antimicrobial Peptides

Beta-defensin 8 , gallinacin - 8

[Price Inquiry]
CAT#
AF2898
Sequence
NNEAQCEQAGGICSKDHCFHLHTRAFGHCQRGVPCCRTVYD
Host Chemicals
Gallus gallus
Length
41
Activity
Antibacterial
SwissProt ID
Q6IV23
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2017 Creative Peptides. All rights reserved.