Home > Product > Antimicrobial Peptides > Beta-defensin 1

Antimicrobial Peptides

Beta-defensin 1

[Price Inquiry]
CAT#
AF2404
Sequence
DQYICARKGGTCNFSPCPLFTRIDGTCYRGKAKCC
Host Chemicals
Canis lupus familiaris
Length
35
Activity
Antimicrobial
SwissProt ID
Q30KV2
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.