Home > Product > Antimicrobial Peptides > Beta-defensin 8

Antimicrobial Peptides

Beta-defensin 8

[Price Inquiry]
CAT#
AF2449
Sequence
NEPVSCIRNGGICQYRCIGLRHKIGTCGSPFKCCK
Host Chemicals
Mus musculus
Length
35
Activity
Antibacterial
SwissProt ID
Q91V82
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.