Home > Product > Antimicrobial Peptides > Beta-defensin 2

Antimicrobial Peptides

Beta-defensin 2

[Price Inquiry]
CAT#
AF2489
Sequence
DPVTCLKNGAICHPVFCPRRYKQIGTCGLPGTKCCK
Host Chemicals
Macaca mulatta
Length
36
Activity
Antibacterial
SwissProt ID
Q9BDS9
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2017 Creative Peptides. All rights reserved.