Home > Product > Antimicrobial Peptides > Beta-defensin 4

Antimicrobial Peptides

warning All products are for research use only. Not for human use.

Beta-defensin 4

[Price Inquiry]
CAT#
AF2490
Sequence
DPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCK
Host Chemicals
Pan troglodytes
Length
36
Activity
Antimicrobial
SwissProt ID
Q9TT12
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.