Home > Product > Antimicrobial Peptides > Beta-defensin 39

Antimicrobial Peptides

Beta-defensin 39

[Price Inquiry]
CAT#
AF2491
Sequence
DSIQCFQKNNTCHTNQCPYFQDEIGTCYDRRGKCCQ
Host Chemicals
Mus musculus
Length
36
Activity
Antibacterial
SwissProt ID
Q70KL3
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.