Home > Product > Antimicrobial Peptides > Beta defensin

Antimicrobial Peptides

warning All products are for research use only. Not for human use.

Beta defensin

[Price Inquiry]
CAT#
AF2516
Sequence
NHRSCHRIKGVCAPDRCPRNMRQIGTCFGPPVKCCR
Host Chemicals
Capra hircus
Length
36
Activity
Antimicrobial
SwissProt ID
Q19AK9
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.