Home > Product > Antimicrobial Peptides > Beta-defensin 5

Antimicrobial Peptides

Beta-defensin 5

[Price Inquiry]
CAT#
AF2519
Sequence
NPQSCRWNMGVCIPISCPGNMRQIGTCFGPRVPCCR
Host Chemicals
Bos taurus
Length
36
Activity
Antimicrobial
SwissProt ID
P46163
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.