Home > Product > Antimicrobial Peptides > Beta-defensin 103

Antimicrobial Peptides

warning All products are for research use only. Not for human use.

Beta-defensin 103

[Price Inquiry]
CAT#
AF2533
Sequence
QKYYCRVRGGRCAVLTCLPKEEQIGKCSTRGRKCCR
Host Chemicals
Pan troglodytes troglodytes
Length
36
Activity
Antimicrobial
SwissProt ID
Q95JD2
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.