Home > Product > Antimicrobial Peptides > Beta-defensin 10

Antimicrobial Peptides

Beta-defensin 10

[Price Inquiry]
CAT#
AF2661
Sequence
NNEAQCEQAGGICSKDHCFHLHTRAFGHCQRGVPCRT
Host Chemicals
Gallus gallus
Length
37
Activity
Antibacterial
SwissProt ID
Q6QLQ9
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.