Home > Product > Antimicrobial Peptides > Beta-defensin 5

Antimicrobial Peptides

warning All products are for research use only. Not for human use.

Beta-defensin 5

[Price Inquiry]
CAT#
AF2690
Sequence
ADTLACRQSHGSCSFVACRAPSVDIGTCRGGLKKCCKW
Host Chemicals
Gallus gallus
Length
38
Activity
Antibacterial
SwissProt ID
Q6IV26
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.