Home > Product > Antimicrobial Peptides > Beta-defensin 2

Antimicrobial Peptides

Beta-defensin 2

[Price Inquiry]
CAT#
AF2882
Sequence
GISDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP
Host Chemicals
Pan troglodytes
Length
41
Activity
Antibacterial
SwissProt ID
Q9TT12
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.