Home > Product > Antimicrobial Peptides > Beta-defensin 5

Antimicrobial Peptides

Beta-defensin 5

Price Inquiry
CAT#
AF2904
Sequence
QSINNPVSCVTHGGICWGRCPGSFRQIGTCGLGKVRCCKKK
Host Chemicals
Rattus norvegicus
Length
41
Activity
Antibacterial
SwissProt ID
Q32ZI3

Online Inquiry

First Name:
Last Name:
Phone:
Email: *
Service & Products of Interest: *
Services Required and Project Description:
Verification code: *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.