Home > Product > Antimicrobial Peptides > Beta-defensin 2

Antimicrobial Peptides

warning All products are for research use only. Not for human use.

Beta-defensin 2

[Price Inquiry]
CAT#
AF2942
Sequence
HGVTDSLSCRWKKGICVLTRCPGTMRQIGTCFGPPVKCCRLK
Host Chemicals
Ovis aries
Length
42
Activity
Antibacterial
SwissProt ID
O19039
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.