Home > Product > Antimicrobial Peptides > Beta-defensin 6

Antimicrobial Peptides

Beta-defensin 6

[Price Inquiry]
CAT#
AF2954
Sequence
QGVRNHVTCRIYGGFCVPIRCPGRTRQIGTCFGRPVKCCRRW
Host Chemicals
Bos taurus
Length
42
Activity
Antibacterial
SwissProt ID
P46164
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.