Home > Product > Antimicrobial Peptides > Beta-defensin 33

Antimicrobial Peptides

Beta-defensin 33

[Price Inquiry]
CAT#
AF2960
Sequence
RKRNSKFRPCEKMGGICKSQKTHGCSILPAECKSRYKHCCRL
Host Chemicals
Mus musculus
Length
42
Activity
Antibacterial
SwissProt ID
Q30KN3
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.