Home > Product > Antimicrobial Peptides > Beta-defensin 38

Antimicrobial Peptides

Beta-defensin 38

[Price Inquiry]
CAT#
AF2965
Sequence
TDQDTAKCVQKKNVCYYFECPWLSISVSTCYKGKAKCCQKRY
Host Chemicals
Rattus norvegicus
Length
42
Activity
Antibacterial
SwissProt ID
Q32ZF8
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.