Home > Product > Antimicrobial Peptides > Beta-defensin 118

Antimicrobial Peptides

Beta-defensin 118

[Price Inquiry]
CAT#
AF2986
Sequence
AYSGEKKCWNRSGHCRKQCKDGEAVKDTCKNLRACCIPSNEDH
Host Chemicals
Homo sapiens
Length
43
Activity
Antibacterial
SwissProt ID
Q96PH6
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.