Home > Product > Antimicrobial Peptides > Beta-defensin 14

Antimicrobial Peptides

Beta-defensin 14

[Price Inquiry]
CAT#
AF3138
Sequence
FLPKTLRKFFCRIRGGRCAVLNCLGKEEQIGRCSNSGRKCCRKKK
Host Chemicals
Mus musculus
Length
45
Activity
Antimicrobial
SwissProt ID
Q7TNV9
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.