Home > Product > Antimicrobial Peptides > Beta-defensin 11 precursor

Antimicrobial Peptides

Beta-defensin 11 precursor

[Price Inquiry]
CAT#
AF2714
Sequence
GPLSCRRNGGVCIPIRCPGPMRQIGTCFGRPVKCCRSW
Host Chemicals
Bos taurus
Length
38
Activity
Antibacterial
SwissProt ID
P46169
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.