Home > Product > Antimicrobial Peptides > Beta-defensin103A

Antimicrobial Peptides

warning All products are for research use only. Not for human use.

Beta-defensin103A

[Price Inquiry]
CAT#
AF3145
Sequence
GIINMLQKSYCKIRKGRCALLGCLPKEEQIGSCSVSGRKCCRKKK
Host Chemicals
Equus caballus
Length
45
Activity
Antibacterial
SwissProt ID
Q0W9P9
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.