Home > Product > Antimicrobial Peptides > Beta-defensin107A

Antimicrobial Peptides

Beta-defensin107A

[Price Inquiry]
CAT#
AF3051
Sequence
AIHRALICKRMEGHCEAECLTFEVKIGGCRAELAPFCCKNRKKH
Host Chemicals
Hylobates lar
Length
44
Activity
Antibacterial
SwissProt ID
A4H217
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2017 Creative Peptides. All rights reserved.