Keywords Search Google Search Search

Beta-defensin118

Specification Technical Data Related Products Featured Products Customer reviews and Q&A Useful Tools Publications

CAT#	AF2985
Sequence	AYGGEKKCWNRSGHCRKQCKDGEAVKETCKNHRACCVPSNEDH
Activity	Antibacterial

CAT#	Product Name	Inquiry
AF193	Temporin 1OLb	Inquiry
AF1688	Ranatuerin-2Mb	Inquiry
AF2677	Antibacterial protein LL-37	Inquiry
AF2217	Ranatuerin-2AMb protein	Inquiry
AF3087	Antimicrobial peptide C22 precursor	Inquiry

CAT#	Product Name	M.W	Molecular Formula	Inquiry
10-101-20	Goserelin Acetate	1269.43	C59H84N18O14	Inquiry
10-101-59	Liraglutide	3751.2	C172H265N43O51	Inquiry
R1574	Octreotide	1019.24	C₄₉H₆₆N₁₀O₁₀S₂	Inquiry
10-101-139	Myrcludex B			Inquiry
10-101-285	Teduglutide	3752.08	C164H252N44O55S	Inquiry
R1847	Sermaglutide	4114	C187H291N45O59	Inquiry
R1961	Carbetocin	988.2	C45H69N11O12S	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

The effect of terlipressin acetate in the treatment of decompensated liver cirrhosis

Somatostatin is the main hemostatic drug in the clinic, and its derivative octreotide has been confirmed by many ...

Palmitoyl Hexapeptide-12, a natural powerful antiager

Introduce of lipopeptide Lipopeptide (peptidolipid), also known as acylpeptide, is composed of hydrophilic peptide bond and l ...

Function of R8-T198wt in prostate cancer

The serine/threonine kinase Pim-1 plays an important role in cell cycle progression and apoptosis inhibition, re ...

Function of pramlintide in diabetes

Pramlintide is a synthetic analogue of pancreatic amyloid polypeptide. Pancreatic amyloid polypeptide is a polyp ...

Novel Peptide Drugs to Treat Multiple Diseases (Part Two)

5. Synthetic Peptides Targeting CD36 Attenuate Lipopolysaccharide-Induced InflammationSynthetic amphipathic helical peptides ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address:

Host Chemicals	Macaca mulatta
Length	43
SwissProt ID	Q95LI0