Home > Product > Antimicrobial Peptides > Beta-defensin118

Antimicrobial Peptides

Beta-defensin118

[Price Inquiry]
CAT#
AF2987
Sequence
AYSGEKKCWNRSGHCRKQCKDGEAVKDTCKNLRACCVPSNEDH
Host Chemicals
Pan troglodytes
Length
43
Activity
Antibacterial
SwissProt ID
Q30KK9
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.