Home > Product > Antimicrobial Peptides > Beta-defensin126

Antimicrobial Peptides

Beta-defensin126

[Price Inquiry]
CAT#
AF3022
Sequence
NWYVKKCLNDVGICKKKCKPEELHVKNGRAMCGKQRDCCVPAD
Host Chemicals
Hylobates lar
Length
43
Activity
Antibacterial
SwissProt ID
A4H245
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.