Home > Product > Antimicrobial Peptides > Beta-defensin127

Antimicrobial Peptides

Beta-defensin127

[Price Inquiry]
CAT#
AF3015
Sequence
LKKCWNNYVQGHCRKICRVNEVPEALCENGRYCCLNIKELEAC
Host Chemicals
Pan troglodytes
Length
43
Activity
Antibacterial
SwissProt ID
Q30KK1
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.